PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf03074g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 309aa    MW: 35884.9 Da    PI: 7.9981
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf03074g00007.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF36.36.9e-12445344
                              --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
                    SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                              i+ +  r+ tf kR++g+ KK +E  +LC+++ ++i++++++
  Peinf101Scf03074g00007.1  4 ISKEKVRNATFKKRKEGLKKKLHEFTTLCNVNGCMIMYGPKQ 45
                              7888899********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.07E-12183IPR002100Transcription factor, MADS-box
PROSITE profilePS5006611.886144IPR002100Transcription factor, MADS-box
SMARTSM004324.0E-4158IPR002100Transcription factor, MADS-box
PfamPF003195.3E-13445IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MELISKEKVR NATFKKRKEG LKKKLHEFTT LCNVNGCMIM YGPKQSDGSN SEPEIWTTNS  60
TTTESLQEEE VQNLIDEYKK SSTVTRSGKT FGLSDYFIDR NKNVEKELIK LKKMNMEKKY  120
PCWVKDMDHL SEIKLRKFIS FLDNKIEKVK FRIDFFKGNM NIASEYFKEA AAEGMELSQL  180
TNYCDNVSHL MVQGGSEWGS FMNNHHEQAF YPYCDSIINH HEQAIYPYWQ YNGAASSCND  240
IRGALMNYET MMTHTAMCNN QRPYSPYVAP TIPQPAPCMM VPSAFPQMDL PRRENEHDVK  300
GKSLPYLRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009774508.11e-131PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLM1CBS41e-108M1CBS4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000641201e-107(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24572253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58890.13e-13AGAMOUS-like 82